PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462872890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HD-ZIP
Protein Properties Length: 659aa    MW: 72729.8 Da    PI: 8.6735
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462872890genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.48.8e-171872256
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               ++ +++t++q e+Le +F  + +p++++r++L++ +gLt +qVk+WFqN+R+  k
  462872890 18 KSLQRLTSSQSEILEGFFSVCAHPTEKQRKKLTETTGLTANQVKFWFQNKRTHVK 72
               556789*********************************************9876 PP

2START92.86.9e-301763912204
                HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.......EEEEEEEECT CS
      START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla.......kaetleviss 87 
                +a  a  elv++a+ ++p+W  ++    e +n   ++q f+ + +    ++ea ra +vv  ++   ve l+d    + + ++         ++++   +
  462872890 176 IARNAVHELVRLASTDSPMWLPVPggslETLNMIAYIQAFPGQSSamgVKVEATRANAVVMLDSKSIVEFLMDAE-SYGTFFPeimpgatNTKVYNWPPN 274
                6778999*********************************665559999****************9999999998.777777766667766667766666 PP

                T.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHH CS
      START  88 g.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwll 181
                      gal+lm+ +l+++splvp R+ +f+Ry+++l+ g  ++vd+Svd  + + +      +++ pSgiliep   + +kvt +ehv l+g  +h l+
  462872890 275 RdaaydGALELMTVDLVLPSPLVPaRKCTFLRYCQKLEHGAIAVVDISVDDGEGNFN-----ECRKMPSGILIEPIRPNTCKVTAIEHVQLGGTDVHDLF 369
                599***********************************************9999865.....899*********************************** PP

                HHHHHHHHHHHHHHHHHHTXXXX CS
      START 182 rslvksglaegaktwvatlqrqc 204
                ++ + sgl +ga++wv  + rq 
  462872890 370 KPCL-SGLLFGARRWVMSMARQS 391
                **98.699********9888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-17368IPR009057Homeodomain-like
SuperFamilySSF466892.47E-151173IPR009057Homeodomain-like
PROSITE profilePS5007115.1921474IPR001356Homeobox domain
SMARTSM003893.6E-141678IPR001356Homeobox domain
CDDcd000861.64E-131773No hitNo description
PfamPF000462.0E-141872IPR001356Homeobox domain
PROSITE profilePS5084825.363166396IPR002913START domain
CDDcd088751.38E-72174392No hitNo description
SuperFamilySSF559612.06E-19174368No hitNo description
SMARTSM002345.8E-5175393IPR002913START domain
PfamPF018522.1E-22176391IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MRREGPSDGR DRPQAKKKSL QRLTSSQSEI LEGFFSVCAH PTEKQRKKLT ETTGLTANQV  60
KFWFQNKRTH VKHLSGKEEN YKLKVENEIL REENNKLKQA KRAIFCPSCP SEPGKVQIFQ  120
ELEMLKAQNE WMKKEVSRLN SEIAMSSSAL SRASQLESSS ENVFVMQDDA QIRAEIARNA  180
VHELVRLAST DSPMWLPVPG GSLETLNMIA YIQAFPGQSS AMGVKVEATR ANAVVMLDSK  240
SIVEFLMDAE SYGTFFPEIM PGATNTKVYN WPPNRDAAYD GALELMTVDL VLPSPLVPAR  300
KCTFLRYCQK LEHGAIAVVD ISVDDGEGNF NECRKMPSGI LIEPIRPNTC KVTAIEHVQL  360
GGTDVHDLFK PCLSGLLFGA RRWVMSMARQ SARMRDVFHV TNSSMSVSTK GRKIIMKMAD  420
TLLANYASSM VGIPAESWIV QCGQGTEQDI KIMYRRNENG SNTAIVCASA SFLVPVPMRS  480
AFDLLKCNML RSKWDVLVNG GNVKEEVRVA NGIGTDDSVT ILHVKHGNKG KKETSMILQN  540
CSYDASGSFL VYSALDKQLL DMIMSPGAGQ EIGNVPVFPT GFYLVPVADA TRPNAPIGEA  600
GGTVMTAGFQ ILMKLARGTG LCPRSVASAI RILSDQIENV KDTMLNSHPI FYKRVPPTN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLK3XF210.0K3XF21_SETIT; Uncharacterized protein
STRINGSi000488m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-108protodermal factor 2